Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

9,271 – 9,285 of 119,743 results

9,271

Novus Biologicals™ DCUN1D2 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

9,272

Promotions Available

R&D Systems™ Recombinant Rhesus Macaque IL-4 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Gene Alias	B cell growth factor 1, BCDF, B-cell stimulatory factor 1, BCGF1, BCGF-1, binetrakin, BSF1, BSF-1, IL4, IL-4B_cell stimulatory factor 1, IL4E12, interleukin 4, interleukin-4, Lymphocyte stimulatory factor 1, MGC79402, Pitrakinra
Molecular Weight (g/mol)	15.1 kDa
Quantity	10 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived rhesus macaque IL-4 protein His25-Ser153,with an N-terminal Met
Recombinant	Recombinant
Name	IL-4

9,273

Novus Biologicals™ Recombinant T. gondii Profilin Protein

Recombinant Protein

Pricing & Availability

9,274

MP Biomedicals™ Bovine Fibrinogen 90% Clottable

A blood protein that is involved in clotting and is converted to fibrin by thrombin

Pricing & Availability

9,275

Promotions Available

R&D Systems™ Recombinant Mouse IL-3 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Buffer	Lyophilized from a 0.2μm filtered solution in PBS.
Purity or Quality Grade	>97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	15 kDa
Gene Symbol	Il3
Endotoxin Concentration	<0.10 EU per 1 μg of the protein by the LAL method.
Storage Requirements	Manual defrost freezer; Avoid repeated freeze-thaw cycles; 12 mo. from receipt, -20 to -70°C as supplied; 1 mo, 2 to 8°C under sterile conditions after reconstitution; 3 mo, -20 to -70°C under sterile conditions after reconstitution
For Use With (Application)	Bioactivity
Source	<EM>E. coli</EM>-derived mouse IL-3 protein Asp33-Cys166, with an N-terminal Met
Accession Number	NP_034686
Regulatory Status	RUO
Gene Alias	Hematopoietic growth factor, IL3, IL-3MGC79398, interleukin 3 (colony-stimulating factor, multiple), interleukin-3, Mast cell growth factor, mast-cell growth factor, MCGF, MCGFMGC79399, MULTI-CSF, multilineage-colony-stimulating factor, Multipotential colony-stimulating factor, P-cell stimulating factor, P-cell-stimulating factor
Gene ID (Entrez)	3562
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS. *1 mg pack size (01M) is supplied as a 0.2 μm filtered solution in PBS.
Reconstitution	Reconstitute at 100 μg/mL in sterile PBS.
Cross Reactivity	IL-3
Species	Mouse

9,276

R&D Systems™ Recombinant Human Ret His-tag Protein

Measured by its binding ability in a functional ELISA.

Pricing & Availability

9,277

Novus Biologicals™ RNF19B Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

9,278

R&D Systems™ Recombinant Rat PDGF-AA Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

9,279

R&D Systems™ Recombinant Mouse Semaphorin 4B Fc Chimera Protein

Measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. Recombinant Mouse Semaphorin 4B Fc Chimera, immobilized at 2.5 μg/mL on a 96 well plate, is able to significantly enhance neurite outgrowth.

Pricing & Availability

9,280

Novus Biologicals™ PCBD1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	PCBD1
Molecular Weight (g/mol)	14.1kDa
Gene ID (Entrez)	5092
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol
Immunogen	PCBD1, 1- 104 aa. MGSSHHHHHHSSGLVPRGSHMAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

9,281

Promotions Available

R&D Systems™ Recombinant Human IFN-gamma R1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	25 kDa
Gene ID (Entrez)	3459
Quantity	100 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Mouse myeloma cell line,NS0-derived human IFN-gamma R1/CD119 protein Met1-Gly245
Recombinant	Recombinant
Name	IFN-gamma R1/CD119

9,282

R&D Systems™ Recombinant Human BMPR-IA/ALK-3 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

9,283

R&D Systems™ Recombinant Human IL-10 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

9,284

MilliporeSigma™ MMP-9, Active, Human, Recombinant Protein

Pricing & Availability

9,285

Novus Biologicals™ Recombinant Human SYT11 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	DKFZp781D015, KIAA0080synaptotagmin 12, MGC10881, MGC17226, synaptotagmin XISYT12, synaptotagmin-11, SytXI
Common Name	SYT11
Molecular Weight (g/mol)	TMW: 47kDa
Gene ID (Entrez)	23208
Formulation	Phosphate buffered saline (pH7.4) containing 50% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

Prev
1
...
617
618
619
620
...
7,983
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ DCUN1D2 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant T. gondii Profilin Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ RNF19B Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PCBD1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human SYT11 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ DCUN1D2 Protein

Novus Biologicals™ Recombinant T. gondii Profilin Protein

Novus Biologicals™ RNF19B Recombinant Protein Antigen

Novus Biologicals™ PCBD1 Protein

Novus Biologicals™ Recombinant Human SYT11 His Protein